A convenient user interface to various classical ciphers. These include:
These classical cryptosystems support alphabets such as:
AUTHORS:
Bases: sage.crypto.cryptosystem.SymmetricKeyCryptosystem
Create an affine cryptosystem.
Let \(A = \{ a_0, a_1, a_2, \dots, a_{n-1} \}\) be a non-empty alphabet consisting of \(n\) unique elements. Define a mapping \(f : A \longrightarrow \ZZ / n\ZZ\) from the alphabet \(A\) to the set \(\ZZ / n\ZZ\) of integers modulo \(n\), given by \(f(a_i) = i\). Thus we can identify each element of the alphabet \(A\) with a unique integer \(0 \leq i < n\). A key of the affine cipher is an ordered pair of integers \((a, b) \in \ZZ / n\ZZ \times \ZZ / n\ZZ\) such that \(\gcd(a, n) = 1\). Therefore the key space is \(\ZZ / n\ZZ \times \ZZ / n\ZZ\). Since we assume that \(A\) does not have repeated elements, the mapping \(f : A \longrightarrow \ZZ/ n\ZZ\) is bijective. Encryption and decryption functions are both affine functions. Let \((a,b)\) be a secret key, i.e. an element of the key space, and let \(p\) be a plaintext character and consequently \(p \in \ZZ / n\ZZ\). Then the ciphertext character \(c\) corresponding to \(p\) is given by
Similarly, given a ciphertext character \(c \in \ZZ / n\ZZ\) and a secret key \((a,b)\), we can recover the corresponding plaintext character as follows:
where \(a^{-1}\) is the inverse of \(a\) modulo \(n\). Use the bijection \(f : A \longrightarrow \ZZ / n\ZZ\) to convert \(c\) and \(p\) back to elements of the alphabet \(A\). Currently, only the following alphabet is supported for the affine cipher:
EXAMPLES:
Encryption and decryption over the capital letters of the English alphabet:
sage: A = AffineCryptosystem(AlphabeticStrings()); A
Affine cryptosystem on Free alphabetic string monoid on A-Z
sage: P = A.encoding("The affine cryptosystem generalizes the shift cipher.")
sage: P
THEAFFINECRYPTOSYSTEMGENERALIZESTHESHIFTCIPHER
sage: a, b = (9, 13)
sage: C = A.enciphering(a, b, P); C
CYXNGGHAXFKVSCJTVTCXRPXAXKNIHEXTCYXTYHGCFHSYXK
sage: A.deciphering(a, b, C)
THEAFFINECRYPTOSYSTEMGENERALIZESTHESHIFTCIPHER
sage: A.deciphering(a, b, C) == P
True
We can also use functional notation to work through the previous example:
sage: A = AffineCryptosystem(AlphabeticStrings()); A
Affine cryptosystem on Free alphabetic string monoid on A-Z
sage: P = A.encoding("The affine cryptosystem generalizes the shift cipher.")
sage: P
THEAFFINECRYPTOSYSTEMGENERALIZESTHESHIFTCIPHER
sage: a, b = (9, 13)
sage: E = A(a, b); E
Affine cipher on Free alphabetic string monoid on A-Z
sage: C = E(P); C
CYXNGGHAXFKVSCJTVTCXRPXAXKNIHEXTCYXTYHGCFHSYXK
sage: aInv, bInv = A.inverse_key(a, b)
sage: D = A(aInv, bInv); D
Affine cipher on Free alphabetic string monoid on A-Z
sage: D(C)
THEAFFINECRYPTOSYSTEMGENERALIZESTHESHIFTCIPHER
sage: D(C) == P
True
sage: D(C) == P == D(E(P))
True
Encrypting the ciphertext with the inverse key also produces the plaintext:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: P = A.encoding("Encrypt with inverse key.")
sage: a, b = (11, 8)
sage: C = A.enciphering(a, b, P)
sage: P; C
ENCRYPTWITHINVERSEKEY
AVENMRJQSJHSVFANYAOAM
sage: aInv, bInv = A.inverse_key(a, b)
sage: A.enciphering(aInv, bInv, C)
ENCRYPTWITHINVERSEKEY
sage: A.enciphering(aInv, bInv, C) == P
True
For a secret key \((a,b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ\), if \(a = 1\) then any affine cryptosystem with key \((1, b)\) for any \(b \in \ZZ/n\ZZ\) is a shift cryptosystem. Here is how we can create a Caesar cipher using an affine cipher:
sage: caesar = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (1, 3)
sage: P = caesar.encoding("abcdef"); P
ABCDEF
sage: C = caesar.enciphering(a, b, P); C
DEFGHI
sage: caesar.deciphering(a, b, C) == P
True
Any affine cipher with keys of the form \((a,0) \in \ZZ/n\ZZ \times \ZZ/n\ZZ\) is called a decimation cipher on the Roman alphabet, or decimation cipher for short:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: P = A.encoding("A decimation cipher is a specialized affine cipher.")
sage: a, b = (17, 0)
sage: C = A.enciphering(a, b, P)
sage: P; C
ADECIMATIONCIPHERISASPECIALIZEDAFFINECIPHER
AZQIGWALGENIGVPQDGUAUVQIGAFGJQZAHHGNQIGVPQD
sage: A.deciphering(a, b, C) == P
True
Generate a random key for encryption and decryption:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: P = A.encoding("An affine cipher with a random key.")
sage: a, b = A.random_key()
sage: C = A.enciphering(a, b, P)
sage: A.deciphering(a, b, C) == P
True
TESTS:
The binary number system is currently not a supported alphabet of this affine cryptosystem:
sage: AffineCryptosystem(BinaryStrings())
Traceback (most recent call last):
...
TypeError: A (= Free binary string monoid) is not supported as a cipher domain of this affine cryptosystem.
Nor are the octal, hexadecimal, and radix-64 number systems supported:
sage: AffineCryptosystem(OctalStrings())
Traceback (most recent call last):
...
TypeError: A (= Free octal string monoid) is not supported as a cipher domain of this affine cryptosystem.
sage: AffineCryptosystem(HexadecimalStrings())
Traceback (most recent call last):
...
TypeError: A (= Free hexadecimal string monoid) is not supported as a cipher domain of this affine cryptosystem.
sage: AffineCryptosystem(Radix64Strings())
Traceback (most recent call last):
...
TypeError: A (= Free radix 64 string monoid) is not supported as a cipher domain of this affine cryptosystem.
A secret key \((a,b)\) must be an element of \(\ZZ/n\ZZ \times \ZZ/n\ZZ\) with \(\gcd(a,n) = 1\). This rules out the case \(a = 0\) irrespective of the value of \(b\). For the upper-case letters of the English alphabet, where the alphabet size is \(n = 26\), \(a\) cannot take on any even value:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: A(0, 1)
Traceback (most recent call last):
...
ValueError: (a, b) = (0, 1) is outside the range of acceptable values for a key of this affine cryptosystem.
sage: A(2, 1)
Traceback (most recent call last):
...
ValueError: (a, b) = (2, 1) is outside the range of acceptable values for a key of this affine cryptosystem.
REFERENCES:
| [Sti06] | Douglas R. Stinson. Cryptography: Theory and Practice. 3rd edition, Chapman & Hall/CRC, 2006. |
Attempt a brute force cryptanalysis of the ciphertext C.
INPUT:
OUTPUT:
EXAMPLES:
Cryptanalyze using all possible keys with the option ranking="none":
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (3, 7)
sage: P = A.encoding("Linear"); P
LINEAR
sage: C = A.enciphering(a, b, P)
sage: L = A.brute_force(C)
sage: sorted(L.items())[:26] # display 26 candidate decipherments
[((1, 0), OFUTHG),
((1, 1), NETSGF),
((1, 2), MDSRFE),
((1, 3), LCRQED),
((1, 4), KBQPDC),
((1, 5), JAPOCB),
((1, 6), IZONBA),
((1, 7), HYNMAZ),
((1, 8), GXMLZY),
((1, 9), FWLKYX),
((1, 10), EVKJXW),
((1, 11), DUJIWV),
((1, 12), CTIHVU),
((1, 13), BSHGUT),
((1, 14), ARGFTS),
((1, 15), ZQFESR),
((1, 16), YPEDRQ),
((1, 17), XODCQP),
((1, 18), WNCBPO),
((1, 19), VMBAON),
((1, 20), ULAZNM),
((1, 21), TKZYML),
((1, 22), SJYXLK),
((1, 23), RIXWKJ),
((1, 24), QHWVJI),
((1, 25), PGVUIH)]
Use the chi-square ranking function, i.e. ranking="chisquare":
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (3, 7)
sage: P = A.encoding("Linear functions for encrypting and decrypting."); P
LINEARFUNCTIONSFORENCRYPTINGANDDECRYPTING
sage: C = A.enciphering(a, b, P)
sage: Rank = A.brute_force(C, ranking="chisquare")
sage: Rank[:10] # display only the top 10 candidate keys
[((3, 7), LINEARFUNCTIONSFORENCRYPTINGANDDECRYPTING),
((23, 25), VYTCGPBMTENYSTOBSPCTEPIRNYTAGTDDCEPIRNYTA),
((1, 12), CTIHVUKDIBATLIXKLUHIBUPOATINVIEEHBUPOATIN),
((11, 15), HSRYELDAROVSWRQDWLYROLUBVSRIERTTYOLUBVSRI),
((25, 1), NWHIUVFMHOPWEHSFEVIHOVABPWHCUHLLIOVABPWHC),
((25, 7), TCNOABLSNUVCKNYLKBONUBGHVCNIANRROUBGHVCNI),
((15, 4), SHIBVOWZILEHDIJWDOBILOFYEHIRVIGGBLOFYEHIR),
((15, 23), PEFYSLTWFIBEAFGTALYFILCVBEFOSFDDYILCVBEFO),
((7, 10), IDUFHSYXUTEDNULYNSFUTSVGEDURHUMMFTSVGEDUR),
((19, 22), QVETRGABEFUVLENALGTEFGDSUVEHREMMTFGDSUVEH)]
Use the squared differences ranking function, i.e. ranking="squared_differences":
sage: Rank = A.brute_force(C, ranking="squared_differences")
sage: Rank[:10] # display only the top 10 candidate keys
[((3, 7), LINEARFUNCTIONSFORENCRYPTINGANDDECRYPTING),
((23, 6), GJENRAMXEPYJDEZMDANEPATCYJELREOONPATCYJEL),
((23, 25), VYTCGPBMTENYSTOBSPCTEPIRNYTAGTDDCEPIRNYTA),
((19, 22), QVETRGABEFUVLENALGTEFGDSUVEHREMMTFGDSUVEH),
((19, 9), DIRGETNORSHIYRANYTGRSTQFHIRUERZZGSTQFHIRU),
((23, 18), KNIRVEQBITCNHIDQHERITEXGCNIPVISSRTEXGCNIP),
((17, 16), GHORBEIDOJMHFOVIFEROJETWMHOZBOAARJETWMHOZ),
((21, 14), AHEZRMOFEVQHTEBOTMZEVMNIQHEDREKKZVMNIQHED),
((1, 12), CTIHVUKDIBATLIXKLUHIBUPOATINVIEEHBUPOATIN),
((7, 18), SNEPRCIHEDONXEVIXCPEDCFQONEBREWWPDCFQONEB)]
TESTS:
Currently, the binary number system is not supported as an alphabet of this affine cryptosystem:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: BinStr = BinaryStrings()
sage: C = BinStr.encoding("abc")
sage: A.brute_force(C)
Traceback (most recent call last):
...
TypeError: Ciphertext must be encoded using one of the supported cipher domains of this affine cryptosystem.
Nor are the octal, hexadecimal, and radix-64 number systems supported:
sage: OctStr = OctalStrings()
sage: C = OctStr([1, 2, 3])
sage: A.brute_force(C)
Traceback (most recent call last):
...
TypeError: Ciphertext must be encoded using one of the supported cipher domains of this affine cryptosystem.
sage: HexStr = HexadecimalStrings()
sage: C = HexStr.encoding("abc")
sage: A.brute_force(C)
Traceback (most recent call last):
...
TypeError: Ciphertext must be encoded using one of the supported cipher domains of this affine cryptosystem.
sage: RadStr = Radix64Strings()
sage: C = RadStr([1, 2, 3])
sage: A.brute_force(C)
Traceback (most recent call last):
...
TypeError: Ciphertext must be encoded using one of the supported cipher domains of this affine cryptosystem.
Only the chi-square and squared-differences ranking functions are currently supported. The keyword ranking must take on either of the values "none", "chisquare" or "squared_differences":
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (3, 7)
sage: P = A.encoding("Linear")
sage: C = A.enciphering(a, b, P)
sage: A.brute_force(C, ranking="chi")
Traceback (most recent call last):
...
ValueError: Keyword 'ranking' must be either 'none', 'chisquare', or 'squared_differences'.
sage: A.brute_force(C, ranking="")
Traceback (most recent call last):
...
ValueError: Keyword 'ranking' must be either 'none', 'chisquare', or 'squared_differences'.
Decrypt the ciphertext C with the key (a, b) using affine cipher decryption.
INPUT:
OUTPUT:
EXAMPLES:
Decryption over the capital letters of the English alphabet:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (5, 2)
sage: P = A.encoding("Affine functions are linear functions.")
sage: C = A.enciphering(a, b, P); C
CBBQPWBYPMTQUPOCJWFQPWCJBYPMTQUPO
sage: P == A.deciphering(a, b, C)
True
The previous example can also be worked through using functional notation:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (5, 2)
sage: P = A.encoding("Affine functions are linear functions.")
sage: E = A(a, b); E
Affine cipher on Free alphabetic string monoid on A-Z
sage: C = E(P); C
CBBQPWBYPMTQUPOCJWFQPWCJBYPMTQUPO
sage: aInv, bInv = A.inverse_key(a, b)
sage: D = A(aInv, bInv); D
Affine cipher on Free alphabetic string monoid on A-Z
sage: D(C) == P
True
If the ciphertext is an empty string, then the plaintext is also an empty string regardless of the value of the secret key:
sage: a, b = A.random_key()
sage: A.deciphering(a, b, A.encoding(""))
sage: A.deciphering(a, b, A.encoding(" "))
TESTS:
The key must be an ordered pair \((a,b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ\) with \(n\) being the size of the plaintext and ciphertext spaces. Furthermore, \(a\) must be relatively prime to \(n\), i.e. \(\gcd(a,n) = 1\):
sage: A.deciphering(2, 6, P)
Traceback (most recent call last):
...
ValueError: (a, b) = (2, 6) is outside the range of acceptable values for a key of this affine cipher.
Encrypt the plaintext P with the key (a, b) using affine cipher encryption.
INPUT:
OUTPUT:
EXAMPLES:
Encryption over the capital letters of the English alphabet:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (3, 6)
sage: P = A.encoding("Affine ciphers work with linear functions.")
sage: A.enciphering(a, b, P)
GVVETSMEZBSFIUWFKUELBNETSGFVOTMLEWTI
Now work through the previous example using functional notation:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (3, 6)
sage: P = A.encoding("Affine ciphers work with linear functions.")
sage: E = A(a, b); E
Affine cipher on Free alphabetic string monoid on A-Z
sage: E(P)
GVVETSMEZBSFIUWFKUELBNETSGFVOTMLEWTI
If the plaintext is an empty string, then the ciphertext is also an empty string regardless of the value of the secret key:
sage: a, b = A.random_key()
sage: A.enciphering(a, b, A.encoding(""))
sage: A.enciphering(a, b, A.encoding(" "))
TESTS:
The key must be an ordered pair \((a,b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ\) with \(n\) being the size of the plaintext and ciphertext spaces. Furthermore, \(a\) must be relatively prime to \(n\), i.e. \(\gcd(a,n) = 1\):
sage: A.enciphering(2, 6, P)
Traceback (most recent call last):
...
ValueError: (a, b) = (2, 6) is outside the range of acceptable values for a key of this affine cryptosystem.
The encoding of the string S over the string monoid of this affine cipher. For example, if the string monoid of this cryptosystem is AlphabeticStringMonoid, then the encoding of S would be its upper-case equivalent stripped of all non-alphabetic characters. Only the following alphabet is supported for the affine cipher:
INPUT:
OUTPUT:
EXAMPLES:
Encoding over the upper-case letters of the English alphabet:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: A.encoding("Affine cipher over capital letters of the English alphabet.")
AFFINECIPHEROVERCAPITALLETTERSOFTHEENGLISHALPHABET
The argument S can be an empty string, in which case an empty string is returned:
sage: AffineCryptosystem(AlphabeticStrings()).encoding("")
The inverse key corresponding to the secret key \((a,b)\). If \(p\) is a plaintext character so that \(p \in \ZZ/n\ZZ\) and \(n\) is the alphabet size, then the ciphertext \(c\) corresponding to \(p\) is
As \((a,b)\) is a key, then the multiplicative inverse \(a^{-1}\) exists and the original plaintext can be recovered as follows
Therefore the ordered pair \((a^{-1}, -ba^{-1})\) is the inverse key corresponding to \((a,b)\).
INPUT:
OUTPUT:
EXAMPLES:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (1, 2)
sage: A.inverse_key(a, b)
(1, 24)
sage: A.inverse_key(3, 2)
(9, 8)
Suppose that the plaintext and ciphertext spaces are the capital letters of the English alphabet so that \(n = 26\). If \(\varphi(n)\) is the Euler phi function of \(n\), then there are \(\varphi(n)\) integers \(0 \leq a < n\) that are relatively prime to \(n\). For the capital letters of the English alphabet, there are 12 such integers relatively prime to \(n\):
sage: euler_phi(A.alphabet_size())
12
And here is a list of those integers:
sage: n = A.alphabet_size()
sage: L = [i for i in xrange(n) if gcd(i, n) == 1]; L
[1, 3, 5, 7, 9, 11, 15, 17, 19, 21, 23, 25]
Then a secret key \((a,b)\) of this shift cryptosystem is such that \(a\) is an element of the list L in the last example. Any inverse key \((A, B)\) corresponding to \((a,b)\) is such that \(A\) is also in the list L above:
sage: a, b = (3, 9)
sage: a in L
True
sage: aInv, bInv = A.inverse_key(a, b)
sage: aInv, bInv
(9, 23)
sage: aInv in L
True
TESTS:
Any ordered pair of the form \((0, b)\) for any integer \(b\) cannot be a secret key of this affine cipher. Hence \((0, b)\) does not have a corresponding inverse key:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: A.inverse_key(0, 1)
Traceback (most recent call last):
...
ValueError: (a, b) = (0, 1) is outside the range of acceptable values for a key of this affine cipher.
Generate a random key within the key space of this affine cipher. The generated secret key is an ordered pair \((a, b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ\) with \(n\) being the size of the cipher domain and \(\gcd(a, n) = 1\). Let \(\varphi(n)\) denote the Euler phi function of \(n\). Then the affine cipher has \(n \cdot \varphi(n)\) possible keys (see page 10 of [Sti06]).
OUTPUT:
EXAMPLES:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: A.random_key() # random
(17, 25)
If \((a,b)\) is a secret key and \(n\) is the size of the plaintext and ciphertext alphabets, then \(\gcd(a, n) = 1\):
sage: a, b = A.random_key()
sage: n = A.alphabet_size()
sage: gcd(a, n)
1
Use the chi-square statistic to rank all possible keys. Currently, this method only applies to the capital letters of the English alphabet.
ALGORITHM:
Consider a non-empty alphabet \(A\) consisting of \(n\) elements, and let \(C\) be a ciphertext encoded using elements of \(A\). The plaintext \(P\) corresponding to \(C\) is also encoded using elements of \(A\). Let \(M\) be a candidate decipherment of \(C\), i.e. \(M\) is the result of attempting to decrypt \(C\) using a key \((a,b)\) which is not necessarily the same key used to encrypt \(P\). Suppose \(F_A(e)\) is the characteristic frequency probability of \(e \in A\) and let \(F_M(e)\) be the message frequency probability with respect to \(M\). The characteristic frequency probability distribution of an alphabet is the expected frequency probability distribution for that alphabet. The message frequency probability distribution of \(M\) provides a distribution of the ratio of character occurrences over message length. One can interpret the characteristic frequency probability \(F_A(e)\) as the expected probability, while the message frequency probability \(F_M(e)\) is the observed probability. If \(M\) is of length \(L\), then the observed frequency of \(e \in A\) is
and the expected frequency of \(e \in A\) is
The chi-square rank \(R_{\chi^2}(M)\) of \(M\) corresponding to a key \((a,b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ\) is given by
Cryptanalysis by exhaustive key search produces a candidate decipherment \(M_{a,b}\) for each possible key \((a,b)\). For a set \(D = \big\{M_{a_1,b_1}, M_{a_2,b_2}, \dots, M_{a_k,b_k} \big\}\) of all candidate decipherments corresponding to a ciphertext \(C\), the smaller is the rank \(R_{\chi^2}(M_{a_i,b_i})\) the more likely that \((a_i,b_i)\) is the secret key. This key ranking method is based on the Pearson chi-square test [PearsonTest09].
INPUT:
OUTPUT:
EXAMPLES:
Use the chi-square statistic to rank all possible keys and their corresponding decipherment:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (3, 7)
sage: P = A.encoding("Line.")
sage: C = A.enciphering(a, b, P)
sage: Plist = A.brute_force(C)
sage: Rank = A.rank_by_chi_square(C, Plist)
sage: Rank[:10] # display only the top 10 candidate keys
[((1, 1), NETS),
((3, 7), LINE),
((17, 20), STAD),
((5, 2), SLOT),
((5, 5), HADI),
((9, 25), TSLI),
((17, 15), DELO),
((15, 6), ETUN),
((21, 8), ELID),
((7, 17), HCTE)]
As more ciphertext is available, the reliability of the chi-square ranking function increases:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (11, 24)
sage: P = A.encoding("Longer message is more information for cryptanalysis.")
sage: C = A.enciphering(a, b, P)
sage: Plist = A.brute_force(C)
sage: Rank = A.rank_by_chi_square(C, Plist)
sage: Rank[:10] # display only the top 10 candidate keys
[((11, 24), LONGERMESSAGEISMOREINFORMATIONFORCRYPTANALYSIS),
((17, 9), INURFSBFLLHRFDLBNSFDUYNSBHEDNUYNSTSVGEHUHIVLDL),
((9, 18), RMFIUHYUOOSIUWOYMHUWFBMHYSVWMFBMHGHETVSFSREOWO),
((15, 12), VSTACPUCOOGACYOUSPCYTBSPUGNYSTBSPEPIRNGTGVIOYO),
((3, 22), PAFOYLKYGGSOYEGKALYEFTALKSBEAFTALILCVBSFSPCGEG),
((25, 3), OHSRNADNPPFRNVPDHANVSCHADFEVHSCHAJABWEFSFOBPVP),
((7, 25), GHYNVIPVRRLNVFRPHIVFYEHIPLAFHYEHIDITQALYLGTRFR),
((5, 2), NEHCIVKISSUCIWSKEVIWHFEVKUPWEHFEVOVABPUHUNASWS),
((15, 25), IFGNPCHPBBTNPLBHFCPLGOFCHTALFGOFCRCVEATGTIVBLB),
((9, 6), BWPSERIEYYCSEGYIWREGPLWRICFGWPLWRQRODFCPCBOYGY)]
TESTS:
The ciphertext cannot be an empty string:
sage: A.rank_by_chi_square("", Plist)
Traceback (most recent call last):
...
AttributeError: 'str' object has no attribute 'parent'
sage: A.rank_by_chi_square(A.encoding(""), Plist)
Traceback (most recent call last):
...
ValueError: The ciphertext must be a non-empty string.
sage: A.rank_by_chi_square(A.encoding(" "), Plist)
Traceback (most recent call last):
...
ValueError: The ciphertext must be a non-empty string.
The ciphertext must be encoded using the capital letters of the English alphabet as implemented in AlphabeticStrings():
sage: H = HexadecimalStrings()
sage: A.rank_by_chi_square(H.encoding("shift"), Plist)
Traceback (most recent call last):
...
TypeError: The ciphertext must be capital letters of the English alphabet.
sage: B = BinaryStrings()
sage: A.rank_by_chi_square(B.encoding("shift"), Plist)
Traceback (most recent call last):
...
TypeError: The ciphertext must be capital letters of the English alphabet.
The dictionary pdict cannot be empty:
sage: A.rank_by_chi_square(C, {})
Traceback (most recent call last):
...
KeyError: (1, 0)
Use the squared-differences measure to rank all possible keys. Currently, this method only applies to the capital letters of the English alphabet.
ALGORITHM:
Consider a non-empty alphabet \(A\) consisting of \(n\) elements, and let \(C\) be a ciphertext encoded using elements of \(A\). The plaintext \(P\) corresponding to \(C\) is also encoded using elements of \(A\). Let \(M\) be a candidate decipherment of \(C\), i.e. \(M\) is the result of attempting to decrypt \(C\) using a key \((a,b)\) which is not necessarily the same key used to encrypt \(P\). Suppose \(F_A(e)\) is the characteristic frequency probability of \(e \in A\) and let \(F_M(e)\) be the message frequency probability with respect to \(M\). The characteristic frequency probability distribution of an alphabet is the expected frequency probability distribution for that alphabet. The message frequency probability distribution of \(M\) provides a distribution of the ratio of character occurrences over message length. One can interpret the characteristic frequency probability \(F_A(e)\) as the expected probability, while the message frequency probability \(F_M(e)\) is the observed probability. If \(M\) is of length \(L\), then the observed frequency of \(e \in A\) is
and the expected frequency of \(e \in A\) is
The squared-differences, or residual sum of squares, rank \(R_{RSS}(M)\) of \(M\) corresponding to a key \((a,b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ\) is given by
Cryptanalysis by exhaustive key search produces a candidate decipherment \(M_{a,b}\) for each possible key \((a,b)\). For a set \(D = \big\{M_{a_1,b_1}, M_{a_2,b_2}, \dots, M_{a_k,b_k} \big\}\) of all candidate decipherments corresponding to a ciphertext \(C\), the smaller is the rank \(R_{RSS}(M_{a_i,b_i})\) the more likely that \((a_i,b_i)\) is the secret key. This key ranking method is based on the residual sum of squares measure [RSS09].
INPUT:
OUTPUT:
EXAMPLES:
Use the method of squared differences to rank all possible keys and their corresponding decipherment:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (3, 7)
sage: P = A.encoding("Line.")
sage: C = A.enciphering(a, b, P)
sage: Plist = A.brute_force(C)
sage: Rank = A.rank_by_squared_differences(C, Plist)
sage: Rank[:10] # display only the top 10 candidate keys
[((1, 1), NETS),
((15, 6), ETUN),
((7, 17), HCTE),
((3, 7), LINE),
((17, 15), DELO),
((9, 4), EDWT),
((9, 9), POHE),
((21, 8), ELID),
((17, 20), STAD),
((7, 18), SNEP)]
As more ciphertext is available, the reliability of the squared-differences ranking function increases:
sage: A = AffineCryptosystem(AlphabeticStrings())
sage: a, b = (11, 24)
sage: P = A.encoding("Longer message is more information for cryptanalysis.")
sage: C = A.enciphering(a, b, P)
sage: Plist = A.brute_force(C)
sage: Rank = A.rank_by_squared_differences(C, Plist)
sage: Rank[:10] # display only the top 10 candidate keys
[((11, 24), LONGERMESSAGEISMOREINFORMATIONFORCRYPTANALYSIS),
((9, 14), DYRUGTKGAAEUGIAKYTGIRNYTKEHIYRNYTSTQFHEREDQAIA),
((23, 24), DSNEUHIUMMAEUOMISHUONZSHIAROSNZSHKHQXRANADQMOM),
((23, 1), ETOFVIJVNNBFVPNJTIVPOATIJBSPTOATILIRYSBOBERNPN),
((21, 16), VEBGANYAQQOGAMQYENAMBDENYOTMEBDENUNIHTOBOVIQMQ),
((7, 12), TULAIVCIEEYAISECUVISLRUVCYNSULRUVQVGDNYLYTGESE),
((5, 20), ZQTOUHWUEEGOUIEWQHUITRQHWGBIQTRQHAHMNBGTGZMEIE),
((21, 8), JSPUOBMOEECUOAEMSBOAPRSBMCHASPRSBIBWVHCPCJWEAE),
((25, 7), SLWVREHRTTJVRZTHLERZWGLEHJIZLWGLENEFAIJWJSFTZT),
((25, 15), ATEDZMPZBBRDZHBPTMZHEOTMPRQHTEOTMVMNIQRERANBHB)]
TESTS:
The ciphertext cannot be an empty string:
sage: A.rank_by_squared_differences("", Plist)
Traceback (most recent call last):
...
AttributeError: 'str' object has no attribute 'parent'
sage: A.rank_by_squared_differences(A.encoding(""), Plist)
Traceback (most recent call last):
...
ValueError: The ciphertext must be a non-empty string.
sage: A.rank_by_squared_differences(A.encoding(" "), Plist)
Traceback (most recent call last):
...
ValueError: The ciphertext must be a non-empty string.
The ciphertext must be encoded using the capital letters of the English alphabet as implemented in AlphabeticStrings():
sage: H = HexadecimalStrings()
sage: A.rank_by_squared_differences(H.encoding("line"), Plist)
Traceback (most recent call last):
...
TypeError: The ciphertext must be capital letters of the English alphabet.
sage: B = BinaryStrings()
sage: A.rank_by_squared_differences(B.encoding("line"), Plist)
Traceback (most recent call last):
...
TypeError: The ciphertext must be capital letters of the English alphabet.
The dictionary pdict cannot be empty:
sage: A.rank_by_squared_differences(C, {})
Traceback (most recent call last):
...
KeyError: (1, 0)
Bases: sage.crypto.cryptosystem.SymmetricKeyCryptosystem
Create a Hill cryptosystem defined by the \(m\) x \(m\) matrix space over \(\ZZ / N \ZZ\), where \(N\) is the alphabet size of the string monoid S.
INPUT:
OUTPUT:
EXAMPLES:
sage: S = AlphabeticStrings()
sage: E = HillCryptosystem(S,3)
sage: E
Hill cryptosystem on Free alphabetic string monoid on A-Z of block length 3
sage: R = IntegerModRing(26)
sage: M = MatrixSpace(R,3,3)
sage: A = M([[1,0,1],[0,1,1],[2,2,3]])
sage: A
[1 0 1]
[0 1 1]
[2 2 3]
sage: e = E(A)
sage: e
Hill cipher on Free alphabetic string monoid on A-Z of block length 3
sage: e(S("LAMAISONBLANCHE"))
JYVKSKQPELAYKPV
TESTS:
sage: S = AlphabeticStrings()
sage: E = HillCryptosystem(S,3)
sage: E == loads(dumps(E))
True
The row or column dimension of a matrix specifying a block permutation. Encryption and decryption keys of a Hill cipher are square matrices, i.e. the row and column dimensions of an encryption or decryption key are the same. This row/column dimension is referred to as the block length.
OUTPUT:
EXAMPLES:
sage: A = AlphabeticStrings()
sage: n = randint(1, A.ngens() - 1)
sage: H = HillCryptosystem(A, n)
sage: H.block_length() == n
True
Decrypt the ciphertext C using the key A.
INPUT:
OUTPUT:
EXAMPLES:
sage: H = HillCryptosystem(AlphabeticStrings(), 3)
sage: K = H.random_key()
sage: M = H.encoding("Good day, mate! How ya going?")
sage: H.deciphering(K, H.enciphering(K, M)) == M
True
Encrypt the plaintext M using the key A.
INPUT:
OUTPUT:
EXAMPLES:
sage: H = HillCryptosystem(AlphabeticStrings(), 3)
sage: K = H.random_key()
sage: M = H.encoding("Good day, mate! How ya going?")
sage: H.deciphering(K, H.enciphering(K, M)) == M
True
The encoding of the string M over the string monoid of this Hill cipher. For example, if the string monoid of this Hill cipher is AlphabeticStringMonoid, then the encoding of M would be its upper-case equivalent stripped of all non-alphabetic characters.
INPUT:
OUTPUT:
EXAMPLES:
sage: M = "The matrix cipher by Lester S. Hill."
sage: A = AlphabeticStrings()
sage: H = HillCryptosystem(A, 7)
sage: H.encoding(M) == A.encoding(M)
True
The inverse key corresponding to the key A.
INPUT:
OUTPUT:
EXAMPLES:
sage: S = AlphabeticStrings()
sage: E = HillCryptosystem(S,3)
sage: A = E.random_key()
sage: B = E.inverse_key(A)
sage: M = S("LAMAISONBLANCHE")
sage: e = E(A)
sage: c = E(B)
sage: c(e(M))
LAMAISONBLANCHE
A random key within the key space of this Hill cipher. That is, generate a random \(m\) x \(m\) matrix to be used as a block permutation, where \(m\) is the block length of this Hill cipher. If \(n\) is the size of the cryptosystem alphabet, then there are \(n^{m^2}\) possible keys. However the number of valid keys, i.e. invertible \(m\) x \(m\) square matrices, is smaller than \(n^{m^2}\).
OUTPUT:
EXAMPLES:
sage: A = AlphabeticStrings()
sage: n = 3
sage: H = HillCryptosystem(A, n)
sage: K = H.random_key()
sage: Ki = H.inverse_key(K)
sage: M = "LAMAISONBLANCHE"
sage: e = H(K)
sage: d = H(Ki)
sage: d(e(A(M))) == A(M)
True
Bases: sage.crypto.cryptosystem.SymmetricKeyCryptosystem
Create a shift cryptosystem.
Let \(A = \{ a_0, a_1, a_2, \dots, a_{n-1} \}\) be a non-empty alphabet consisting of \(n\) unique elements. Define a mapping \(f : A \longrightarrow \ZZ/ n\ZZ\) from the alphabet \(A\) to the set \(\ZZ / n\ZZ\) of integers modulo \(n\), given by \(f(a_i) = i\). Thus we can identify each element of the alphabet \(A\) with a unique integer \(0 \leq i < n\). A key of the shift cipher is an integer \(0 \leq k < n\). Therefore the key space is \(\ZZ / n\ZZ\). Since we assume that \(A\) does not have repeated elements, the mapping \(f : A \longrightarrow \ZZ/ n\ZZ\) is bijective. Encryption works by moving along the alphabet by \(k\) positions, with wrap around. Decryption reverses the process by moving backwards by \(k\) positions, with wrap around. More generally, let \(k\) be a secret key, i.e. an element of the key space, and let \(p\) be a plaintext character and consequently \(p \in \ZZ / n\ZZ\). Then the ciphertext character \(c\) corresponding to \(p\) is given by
Similarly, given a ciphertext character \(c \in \ZZ / n\ZZ\) and a secret key \(k\), we can recover the corresponding plaintext character as follows:
Use the bijection \(f : A \longrightarrow \ZZ/ n\ZZ\) to convert \(c\) and \(p\) back to elements of the alphabet \(A\). Currently, the following alphabets are supported for the shift cipher:
EXAMPLES:
Some examples illustrating encryption and decryption over various alphabets. Here is an example over the upper-case letters of the English alphabet:
sage: S = ShiftCryptosystem(AlphabeticStrings()); S
Shift cryptosystem on Free alphabetic string monoid on A-Z
sage: P = S.encoding("The shift cryptosystem generalizes the Caesar cipher.")
sage: P
THESHIFTCRYPTOSYSTEMGENERALIZESTHECAESARCIPHER
sage: K = 7
sage: C = S.enciphering(K, P); C
AOLZOPMAJYFWAVZFZALTNLULYHSPGLZAOLJHLZHYJPWOLY
sage: S.deciphering(K, C)
THESHIFTCRYPTOSYSTEMGENERALIZESTHECAESARCIPHER
sage: S.deciphering(K, C) == P
True
The previous example can also be done as follows:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: P = S.encoding("The shift cryptosystem generalizes the Caesar cipher.")
sage: K = 7
sage: E = S(K); E
Shift cipher on Free alphabetic string monoid on A-Z
sage: C = E(P); C
AOLZOPMAJYFWAVZFZALTNLULYHSPGLZAOLJHLZHYJPWOLY
sage: D = S(S.inverse_key(K)); D
Shift cipher on Free alphabetic string monoid on A-Z
sage: D(C) == P
True
sage: D(C) == P == D(E(P))
True
Over the hexadecimal number system:
sage: S = ShiftCryptosystem(HexadecimalStrings()); S
Shift cryptosystem on Free hexadecimal string monoid
sage: P = S.encoding("Encryption & decryption shifts along the alphabet."); P
456e6372797074696f6e20262064656372797074696f6e2073686966747320616c6f6e672074686520616c7068616265742e
sage: K = 5
sage: C = S.enciphering(K, P); C
9ab3b8c7cec5c9beb4b3757b75b9bab8c7cec5c9beb4b375c8bdbebbc9c875b6b1b4b3bc75c9bdba75b6b1c5bdb6b7bac973
sage: S.deciphering(K, C)
456e6372797074696f6e20262064656372797074696f6e2073686966747320616c6f6e672074686520616c7068616265742e
sage: S.deciphering(K, C) == P
True
And over the binary number system:
sage: S = ShiftCryptosystem(BinaryStrings()); S
Shift cryptosystem on Free binary string monoid
sage: P = S.encoding("The binary alphabet is very insecure."); P
01010100011010000110010100100000011000100110100101101110011000010111001001111001001000000110000101101100011100000110100001100001011000100110010101110100001000000110100101110011001000000111011001100101011100100111100100100000011010010110111001110011011001010110001101110101011100100110010100101110
sage: K = 1
sage: C = S.enciphering(K, P); C
10101011100101111001101011011111100111011001011010010001100111101000110110000110110111111001111010010011100011111001011110011110100111011001101010001011110111111001011010001100110111111000100110011010100011011000011011011111100101101001000110001100100110101001110010001010100011011001101011010001
sage: S.deciphering(K, C)
01010100011010000110010100100000011000100110100101101110011000010111001001111001001000000110000101101100011100000110100001100001011000100110010101110100001000000110100101110011001000000111011001100101011100100111100100100000011010010110111001110011011001010110001101110101011100100110010100101110
sage: S.deciphering(K, C) == P
True
A shift cryptosystem with key \(k = 3\) is commonly referred to as the Caesar cipher. Create a Caesar cipher over the upper-case letters of the English alphabet:
sage: caesar = ShiftCryptosystem(AlphabeticStrings())
sage: K = 3
sage: P = caesar.encoding("abcdef"); P
ABCDEF
sage: C = caesar.enciphering(K, P); C
DEFGHI
sage: caesar.deciphering(K, C) == P
True
Generate a random key for encryption and decryption:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: P = S.encoding("Shift cipher with a random key.")
sage: K = S.random_key()
sage: C = S.enciphering(K, P)
sage: S.deciphering(K, C) == P
True
Decrypting with the key K is equivalent to encrypting with its corresponding inverse key:
sage: S.enciphering(S.inverse_key(K), C) == P
True
TESTS:
Currently, the octal number system is not supported as an alphabet for this shift cryptosystem:
sage: ShiftCryptosystem(OctalStrings())
Traceback (most recent call last):
...
TypeError: A (= Free octal string monoid) is not supported as a cipher domain of this shift cryptosystem.
Nor is the radix-64 number system supported:
sage: ShiftCryptosystem(Radix64Strings())
Traceback (most recent call last):
...
TypeError: A (= Free radix 64 string monoid) is not supported as a cipher domain of this shift cryptosystem.
Testing of dumping and loading objects:
sage: SA = ShiftCryptosystem(AlphabeticStrings())
sage: SA == loads(dumps(SA))
True
sage: SH = ShiftCryptosystem(HexadecimalStrings())
sage: SH == loads(dumps(SH))
True
sage: SB = ShiftCryptosystem(BinaryStrings())
sage: SB == loads(dumps(SB))
True
The key K must satisfy the inequality \(0 \leq K < n\) with \(n\) being the size of the plaintext, ciphertext, and key spaces. For the shift cryptosystem, all these spaces are the same alphabet. This inequality must be satisfied for each of the supported alphabets. The capital letters of the English alphabet:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: S(2 + S.alphabet_size())
Traceback (most recent call last):
...
ValueError: K (=28) is outside the range of acceptable values for a key of this shift cryptosystem.
sage: S(-2)
Traceback (most recent call last):
...
ValueError: K (=-2) is outside the range of acceptable values for a key of this shift cryptosystem.
The hexadecimal number system:
sage: S = ShiftCryptosystem(HexadecimalStrings())
sage: S(1 + S.alphabet_size())
Traceback (most recent call last):
...
ValueError: K (=17) is outside the range of acceptable values for a key of this shift cryptosystem.
sage: S(-1)
Traceback (most recent call last):
...
ValueError: K (=-1) is outside the range of acceptable values for a key of this shift cryptosystem.
The binary number system:
sage: S = ShiftCryptosystem(BinaryStrings())
sage: S(1 + S.alphabet_size())
Traceback (most recent call last):
...
ValueError: K (=3) is outside the range of acceptable values for a key of this shift cryptosystem.
sage: S(-2)
Traceback (most recent call last):
...
ValueError: K (=-2) is outside the range of acceptable values for a key of this shift cryptosystem.
Attempt a brute force cryptanalysis of the ciphertext C.
INPUT:
OUTPUT:
EXAMPLES:
Cryptanalyze using all possible keys for various alphabets. Over the upper-case letters of the English alphabet:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: P = S.encoding("The shift cryptosystem generalizes the Caesar cipher.")
sage: K = 7
sage: C = S.enciphering(K, P)
sage: Dict = S.brute_force(C)
sage: for k in xrange(len(Dict)):
... if Dict[k] == P:
... print "key =", k
...
key = 7
Over the hexadecimal number system:
sage: S = ShiftCryptosystem(HexadecimalStrings())
sage: P = S.encoding("Encryption & decryption shifts along the alphabet.")
sage: K = 5
sage: C = S.enciphering(K, P)
sage: Dict = S.brute_force(C)
sage: for k in xrange(len(Dict)):
... if Dict[k] == P:
... print "key =", k
...
key = 5
And over the binary number system:
sage: S = ShiftCryptosystem(BinaryStrings())
sage: P = S.encoding("The binary alphabet is very insecure.")
sage: K = 1
sage: C = S.enciphering(K, P)
sage: Dict = S.brute_force(C)
sage: for k in xrange(len(Dict)):
... if Dict[k] == P:
... print "key =", k
...
key = 1
Don’t use any ranking functions, i.e. ranking="none":
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: P = S.encoding("Shifting using modular arithmetic.")
sage: K = 8
sage: C = S.enciphering(K, P)
sage: pdict = S.brute_force(C)
sage: sorted(pdict.items())
[(0, APQNBQVOCAQVOUWLCTIZIZQBPUMBQK),
(1, ZOPMAPUNBZPUNTVKBSHYHYPAOTLAPJ),
(2, YNOLZOTMAYOTMSUJARGXGXOZNSKZOI),
(3, XMNKYNSLZXNSLRTIZQFWFWNYMRJYNH),
(4, WLMJXMRKYWMRKQSHYPEVEVMXLQIXMG),
(5, VKLIWLQJXVLQJPRGXODUDULWKPHWLF),
(6, UJKHVKPIWUKPIOQFWNCTCTKVJOGVKE),
(7, TIJGUJOHVTJOHNPEVMBSBSJUINFUJD),
(8, SHIFTINGUSINGMODULARARITHMETIC),
(9, RGHESHMFTRHMFLNCTKZQZQHSGLDSHB),
(10, QFGDRGLESQGLEKMBSJYPYPGRFKCRGA),
(11, PEFCQFKDRPFKDJLARIXOXOFQEJBQFZ),
(12, ODEBPEJCQOEJCIKZQHWNWNEPDIAPEY),
(13, NCDAODIBPNDIBHJYPGVMVMDOCHZODX),
(14, MBCZNCHAOMCHAGIXOFULULCNBGYNCW),
(15, LABYMBGZNLBGZFHWNETKTKBMAFXMBV),
(16, KZAXLAFYMKAFYEGVMDSJSJALZEWLAU),
(17, JYZWKZEXLJZEXDFULCRIRIZKYDVKZT),
(18, IXYVJYDWKIYDWCETKBQHQHYJXCUJYS),
(19, HWXUIXCVJHXCVBDSJAPGPGXIWBTIXR),
(20, GVWTHWBUIGWBUACRIZOFOFWHVASHWQ),
(21, FUVSGVATHFVATZBQHYNENEVGUZRGVP),
(22, ETURFUZSGEUZSYAPGXMDMDUFTYQFUO),
(23, DSTQETYRFDTYRXZOFWLCLCTESXPETN),
(24, CRSPDSXQECSXQWYNEVKBKBSDRWODSM),
(25, BQROCRWPDBRWPVXMDUJAJARCQVNCRL)]
Use the chi-square ranking function, i.e. ranking="chisquare":
sage: S.brute_force(C, ranking="chisquare")
[(8, SHIFTINGUSINGMODULARARITHMETIC),
(14, MBCZNCHAOMCHAGIXOFULULCNBGYNCW),
(20, GVWTHWBUIGWBUACRIZOFOFWHVASHWQ),
(13, NCDAODIBPNDIBHJYPGVMVMDOCHZODX),
(1, ZOPMAPUNBZPUNTVKBSHYHYPAOTLAPJ),
(23, DSTQETYRFDTYRXZOFWLCLCTESXPETN),
(10, QFGDRGLESQGLEKMBSJYPYPGRFKCRGA),
(6, UJKHVKPIWUKPIOQFWNCTCTKVJOGVKE),
(22, ETURFUZSGEUZSYAPGXMDMDUFTYQFUO),
(15, LABYMBGZNLBGZFHWNETKTKBMAFXMBV),
(12, ODEBPEJCQOEJCIKZQHWNWNEPDIAPEY),
(21, FUVSGVATHFVATZBQHYNENEVGUZRGVP),
(16, KZAXLAFYMKAFYEGVMDSJSJALZEWLAU),
(25, BQROCRWPDBRWPVXMDUJAJARCQVNCRL),
(9, RGHESHMFTRHMFLNCTKZQZQHSGLDSHB),
(24, CRSPDSXQECSXQWYNEVKBKBSDRWODSM),
(3, XMNKYNSLZXNSLRTIZQFWFWNYMRJYNH),
(5, VKLIWLQJXVLQJPRGXODUDULWKPHWLF),
(7, TIJGUJOHVTJOHNPEVMBSBSJUINFUJD),
(2, YNOLZOTMAYOTMSUJARGXGXOZNSKZOI),
(18, IXYVJYDWKIYDWCETKBQHQHYJXCUJYS),
(4, WLMJXMRKYWMRKQSHYPEVEVMXLQIXMG),
(11, PEFCQFKDRPFKDJLARIXOXOFQEJBQFZ),
(19, HWXUIXCVJHXCVBDSJAPGPGXIWBTIXR),
(0, APQNBQVOCAQVOUWLCTIZIZQBPUMBQK),
(17, JYZWKZEXLJZEXDFULCRIRIZKYDVKZT)]
Use the squared differences ranking function, i.e. ranking="squared_differences":
sage: S.brute_force(C, ranking="squared_differences")
[(8, SHIFTINGUSINGMODULARARITHMETIC),
(23, DSTQETYRFDTYRXZOFWLCLCTESXPETN),
(12, ODEBPEJCQOEJCIKZQHWNWNEPDIAPEY),
(2, YNOLZOTMAYOTMSUJARGXGXOZNSKZOI),
(9, RGHESHMFTRHMFLNCTKZQZQHSGLDSHB),
(7, TIJGUJOHVTJOHNPEVMBSBSJUINFUJD),
(21, FUVSGVATHFVATZBQHYNENEVGUZRGVP),
(22, ETURFUZSGEUZSYAPGXMDMDUFTYQFUO),
(1, ZOPMAPUNBZPUNTVKBSHYHYPAOTLAPJ),
(16, KZAXLAFYMKAFYEGVMDSJSJALZEWLAU),
(20, GVWTHWBUIGWBUACRIZOFOFWHVASHWQ),
(24, CRSPDSXQECSXQWYNEVKBKBSDRWODSM),
(14, MBCZNCHAOMCHAGIXOFULULCNBGYNCW),
(13, NCDAODIBPNDIBHJYPGVMVMDOCHZODX),
(3, XMNKYNSLZXNSLRTIZQFWFWNYMRJYNH),
(10, QFGDRGLESQGLEKMBSJYPYPGRFKCRGA),
(15, LABYMBGZNLBGZFHWNETKTKBMAFXMBV),
(6, UJKHVKPIWUKPIOQFWNCTCTKVJOGVKE),
(11, PEFCQFKDRPFKDJLARIXOXOFQEJBQFZ),
(25, BQROCRWPDBRWPVXMDUJAJARCQVNCRL),
(17, JYZWKZEXLJZEXDFULCRIRIZKYDVKZT),
(19, HWXUIXCVJHXCVBDSJAPGPGXIWBTIXR),
(4, WLMJXMRKYWMRKQSHYPEVEVMXLQIXMG),
(0, APQNBQVOCAQVOUWLCTIZIZQBPUMBQK),
(18, IXYVJYDWKIYDWCETKBQHQHYJXCUJYS),
(5, VKLIWLQJXVLQJPRGXODUDULWKPHWLF)]
TESTS:
Currently, the octal number system is not supported as an alphabet for this shift cryptosystem:
sage: SA = ShiftCryptosystem(AlphabeticStrings())
sage: OctStr = OctalStrings()
sage: C = OctStr([1, 2, 3])
sage: SA.brute_force(C)
Traceback (most recent call last):
...
TypeError: ciphertext must be encoded using one of the supported cipher domains of this shift cryptosystem.
Nor is the radix-64 alphabet supported:
sage: Rad64 = Radix64Strings()
sage: C = Rad64([1, 2, 3])
sage: SA.brute_force(C)
Traceback (most recent call last):
...
TypeError: ciphertext must be encoded using one of the supported cipher domains of this shift cryptosystem.
Decrypt the ciphertext C with the key K using shift cipher decryption.
INPUT:
OUTPUT:
EXAMPLES:
Let’s perform decryption over the supported alphabets. Here is decryption over the capital letters of the English alphabet:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: P = S.encoding("Stop shifting me."); P
STOPSHIFTINGME
sage: K = 13
sage: C = S.enciphering(K, P); C
FGBCFUVSGVATZR
sage: S.deciphering(K, C) == P
True
Decryption over the hexadecimal number system:
sage: S = ShiftCryptosystem(HexadecimalStrings())
sage: P = S.encoding("Shift me now."); P
5368696674206d65206e6f772e
sage: K = 7
sage: C = S.enciphering(K, P); C
cadfd0ddeb97d4dc97d5d6ee95
sage: S.deciphering(K, C) == P
True
Decryption over the binary number system:
sage: S = ShiftCryptosystem(BinaryStrings())
sage: P = S.encoding("OK, enough shifting."); P
0100111101001011001011000010000001100101011011100110111101110101011001110110100000100000011100110110100001101001011001100111010001101001011011100110011100101110
sage: K = 1
sage: C = S.enciphering(K, P); C
1011000010110100110100111101111110011010100100011001000010001010100110001001011111011111100011001001011110010110100110011000101110010110100100011001100011010001
sage: S.deciphering(K, C) == P
True
Encrypt the plaintext P with the key K using shift cipher encryption.
INPUT:
OUTPUT:
EXAMPLES:
Let’s perform encryption over the supported alphabets. Here is encryption over the capital letters of the English alphabet:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: P = S.encoding("Shift your gear."); P
SHIFTYOURGEAR
sage: K = 3
sage: S.enciphering(K, P)
VKLIWBRXUJHDU
Encryption over the hexadecimal number system:
sage: S = ShiftCryptosystem(HexadecimalStrings())
sage: P = S.encoding("Capitalize with the shift key."); P
4361706974616c697a65207769746820746865207368696674206b65792e
sage: K = 5
sage: S.enciphering(K, P)
98b6c5bec9b6b1becfba75ccbec9bd75c9bdba75c8bdbebbc975b0bace73
Encryption over the binary number system:
sage: S = ShiftCryptosystem(BinaryStrings())
sage: P = S.encoding("Don't shift."); P
010001000110111101101110001001110111010000100000011100110110100001101001011001100111010000101110
sage: K = 1
sage: S.enciphering(K, P)
101110111001000010010001110110001000101111011111100011001001011110010110100110011000101111010001
The encoding of the string S over the string monoid of this shift cipher. For example, if the string monoid of this cryptosystem is AlphabeticStringMonoid, then the encoding of S would be its upper-case equivalent stripped of all non-alphabetic characters. The following alphabets are supported for the shift cipher:
INPUT:
OUTPUT:
EXAMPLES:
Encoding over the upper-case letters of the English alphabet:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: S.encoding("Shift cipher on capital letters of the English alphabet.")
SHIFTCIPHERONCAPITALLETTERSOFTHEENGLISHALPHABET
Encoding over the binary system:
sage: S = ShiftCryptosystem(BinaryStrings())
sage: S.encoding("Binary")
010000100110100101101110011000010111001001111001
Encoding over the hexadecimal system:
sage: S = ShiftCryptosystem(HexadecimalStrings())
sage: S.encoding("Over hexadecimal system.")
4f7665722068657861646563696d616c2073797374656d2e
The argument S can be an empty string, in which case an empty string is returned:
sage: ShiftCryptosystem(AlphabeticStrings()).encoding("")
sage: ShiftCryptosystem(HexadecimalStrings()).encoding("")
sage: ShiftCryptosystem(BinaryStrings()).encoding("")
The inverse key corresponding to the key K. For the shift cipher, the inverse key corresponding to K is \(-K \bmod n\), where \(n > 0\) is the size of the cipher domain, i.e. the plaintext/ciphertext space. A key \(k\) of the shift cipher is an integer \(0 \leq k < n\). The key \(k = 0\) has no effect on either the plaintext or the ciphertext.
INPUT:
OUTPUT:
EXAMPLES:
Some random keys and their respective inverse keys:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: key = S.random_key(); key # random
2
sage: S.inverse_key(key) # random
24
sage: S = ShiftCryptosystem(HexadecimalStrings())
sage: key = S.random_key(); key # random
12
sage: S.inverse_key(key) # random
4
sage: S = ShiftCryptosystem(BinaryStrings())
sage: key = S.random_key(); key # random
1
sage: S.inverse_key(key) # random
1
sage: key = S.random_key(); key # random
0
sage: S.inverse_key(key) # random
0
Regardless of the value of a key, the addition of the key and its inverse must be equal to the alphabet size. This relationship holds exactly when the value of the key is non-zero:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: K = S.random_key()
sage: while K == 0:
... K = S.random_key()
...
sage: invK = S.inverse_key(K)
sage: K + invK == S.alphabet_size()
True
sage: invK + K == S.alphabet_size()
True
sage: K = S.random_key()
sage: while K != 0:
... K = S.random_key()
...
sage: invK = S.inverse_key(K)
sage: K + invK != S.alphabet_size()
True
sage: K; invK
0
0
TESTS:
The key K must satisfy the inequality \(0 \leq K < n\) with \(n\) being the size of the plaintext, ciphertext, and key spaces. For the shift cryptosystem, all these spaces are the same alphabet. This inequality must be satisfied for each of the supported alphabets. The capital letters of the English alphabet:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: S.inverse_key(S.alphabet_size())
Traceback (most recent call last):
...
ValueError: K (=26) is outside the range of acceptable values for a key of this shift cryptosystem.
sage: S.inverse_key(-1)
Traceback (most recent call last):
...
ValueError: K (=-1) is outside the range of acceptable values for a key of this shift cryptosystem.
The hexadecimal number system:
sage: S = ShiftCryptosystem(HexadecimalStrings())
sage: S.inverse_key(S.alphabet_size())
Traceback (most recent call last):
...
ValueError: K (=16) is outside the range of acceptable values for a key of this shift cryptosystem.
sage: S.inverse_key(-1)
Traceback (most recent call last):
...
ValueError: K (=-1) is outside the range of acceptable values for a key of this shift cryptosystem.
The binary number system:
sage: S = ShiftCryptosystem(BinaryStrings())
sage: S.inverse_key(S.alphabet_size())
Traceback (most recent call last):
...
ValueError: K (=2) is outside the range of acceptable values for a key of this shift cryptosystem.
sage: S.inverse_key(-1)
Traceback (most recent call last):
...
ValueError: K (=-1) is outside the range of acceptable values for a key of this shift cryptosystem.
Generate a random key within the key space of this shift cipher. The generated key is an integer \(0 \leq k < n\) with \(n\) being the size of the cipher domain. Thus there are \(n\) possible keys in the key space, which is the set \(\ZZ / n\ZZ\). The key \(k = 0\) has no effect on either the plaintext or the ciphertext.
OUTPUT:
EXAMPLES:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: S.random_key() # random
18
sage: S = ShiftCryptosystem(BinaryStrings())
sage: S.random_key() # random
0
sage: S = ShiftCryptosystem(HexadecimalStrings())
sage: S.random_key() # random
5
Regardless of the value of a key, the addition of the key and its inverse must be equal to the alphabet size. This relationship holds exactly when the value of the key is non-zero:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: K = S.random_key()
sage: while K == 0:
... K = S.random_key()
...
sage: invK = S.inverse_key(K)
sage: K + invK == S.alphabet_size()
True
sage: invK + K == S.alphabet_size()
True
sage: K = S.random_key()
sage: while K != 0:
... K = S.random_key()
...
sage: invK = S.inverse_key(K)
sage: K + invK != S.alphabet_size()
True
sage: K; invK
0
0
Use the chi-square statistic to rank all possible keys. Currently, this method only applies to the capital letters of the English alphabet.
ALGORITHM:
Consider a non-empty alphabet \(A\) consisting of \(n\) elements, and let \(C\) be a ciphertext encoded using elements of \(A\). The plaintext \(P\) corresponding to \(C\) is also encoded using elements of \(A\). Let \(M\) be a candidate decipherment of \(C\), i.e. \(M\) is the result of attempting to decrypt \(C\) using a key \(k \in \ZZ/n\ZZ\) which is not necessarily the same key used to encrypt \(P\). Suppose \(F_A(e)\) is the characteristic frequency probability of \(e \in A\) and let \(F_M(e)\) be the message frequency probability with respect to \(M\). The characteristic frequency probability distribution of an alphabet is the expected frequency probability distribution for that alphabet. The message frequency probability distribution of \(M\) provides a distribution of the ratio of character occurrences over message length. One can interpret the characteristic frequency probability \(F_A(e)\) as the expected probability, while the message frequency probability \(F_M(e)\) is the observed probability. If \(M\) is of length \(L\), then the observed frequency of \(e \in A\) is
and the expected frequency of \(e \in A\) is
The chi-square rank \(R_{\chi^2}(M)\) of \(M\) corresponding to a key \(k \in \ZZ/n\ZZ\) is given by
Cryptanalysis by exhaustive key search produces a candidate decipherment \(M_{k}\) for each possible key \(k \in \ZZ/n\ZZ\). For a set \(D = \big\{M_{k_1}, M_{k_2}, \dots, M_{k_r} \big\}\) of all candidate decipherments corresponding to a ciphertext \(C\), the smaller is the rank \(R_{\chi^2}(M_{k_i})\) the more likely that \(k_i\) is the secret key. This key ranking method is based on the Pearson chi-square test [PearsonTest09].
INPUT:
OUTPUT:
EXAMPLES:
Use the chi-square statistic to rank all possible keys and their corresponding decipherment:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: P = S.encoding("Shi."); P
SHI
sage: K = 5
sage: C = S.enciphering(K, P)
sage: Pdict = S.brute_force(C)
sage: S.rank_by_chi_square(C, Pdict)
[(9, ODE),
(5, SHI),
(20, DST),
(19, ETU),
(21, CRS),
(10, NCD),
(25, YNO),
(6, RGH),
(12, LAB),
(8, PEF),
(1, WLM),
(11, MBC),
(18, FUV),
(17, GVW),
(2, VKL),
(4, TIJ),
(3, UJK),
(0, XMN),
(16, HWX),
(15, IXY),
(23, APQ),
(24, ZOP),
(22, BQR),
(7, QFG),
(13, KZA),
(14, JYZ)]
As more ciphertext is available, the reliability of the chi-square ranking function increases:
sage: P = S.encoding("Shift cipher."); P
SHIFTCIPHER
sage: C = S.enciphering(K, P)
sage: Pdict = S.brute_force(C)
sage: S.rank_by_chi_square(C, Pdict)
[(5, SHIFTCIPHER),
(9, ODEBPYELDAN),
(18, FUVSGPVCURE),
(2, VKLIWFLSKHU),
(20, DSTQENTASPC),
(19, ETURFOUBTQD),
(21, CRSPDMSZROB),
(6, RGHESBHOGDQ),
(7, QFGDRAGNFCP),
(12, LABYMVBIAXK),
(17, GVWTHQWDVSF),
(24, ZOPMAJPWOLY),
(1, WLMJXGMTLIV),
(0, XMNKYHNUMJW),
(11, MBCZNWCJBYL),
(8, PEFCQZFMEBO),
(25, YNOLZIOVNKX),
(10, NCDAOXDKCZM),
(3, UJKHVEKRJGT),
(4, TIJGUDJQIFS),
(22, BQROCLRYQNA),
(16, HWXUIRXEWTG),
(15, IXYVJSYFXUH),
(14, JYZWKTZGYVI),
(13, KZAXLUAHZWJ),
(23, APQNBKQXPMZ)]
TESTS:
The ciphertext cannot be an empty string:
sage: S.rank_by_chi_square("", Pdict)
Traceback (most recent call last):
...
AttributeError: 'str' object has no attribute 'parent'
sage: S.rank_by_chi_square(S.encoding(""), Pdict)
Traceback (most recent call last):
...
ValueError: The ciphertext must be a non-empty string.
sage: S.rank_by_chi_square(S.encoding(" "), Pdict)
Traceback (most recent call last):
...
ValueError: The ciphertext must be a non-empty string.
The ciphertext must be encoded using the capital letters of the English alphabet as implemented in AlphabeticStrings():
sage: H = HexadecimalStrings()
sage: S.rank_by_chi_square(H.encoding("shift"), Pdict)
Traceback (most recent call last):
...
TypeError: The ciphertext must be capital letters of the English alphabet.
sage: B = BinaryStrings()
sage: S.rank_by_chi_square(B.encoding("shift"), Pdict)
Traceback (most recent call last):
...
TypeError: The ciphertext must be capital letters of the English alphabet.
The dictionary pdict cannot be empty:
sage: S.rank_by_chi_square(C, {})
Traceback (most recent call last):
...
KeyError: 0
REFERENCES:
| [PearsonTest09] | (1, 2) Pearson chi-square test. Wikipedia, accessed 13th October 2009. |
Use the squared-differences measure to rank all possible keys. Currently, this method only applies to the capital letters of the English alphabet.
ALGORITHM:
Consider a non-empty alphabet \(A\) consisting of \(n\) elements, and let \(C\) be a ciphertext encoded using elements of \(A\). The plaintext \(P\) corresponding to \(C\) is also encoded using elements of \(A\). Let \(M\) be a candidate decipherment of \(C\), i.e. \(M\) is the result of attempting to decrypt \(C\) using a key \(k \in \ZZ/n\ZZ\) which is not necessarily the same key used to encrypt \(P\). Suppose \(F_A(e)\) is the characteristic frequency probability of \(e \in A\) and let \(F_M(e)\) be the message frequency probability with respect to \(M\). The characteristic frequency probability distribution of an alphabet is the expected frequency probability distribution for that alphabet. The message frequency probability distribution of \(M\) provides a distribution of the ratio of character occurrences over message length. One can interpret the characteristic frequency probability \(F_A(e)\) as the expected probability, while the message frequency probability \(F_M(e)\) is the observed probability. If \(M\) is of length \(L\), then the observed frequency of \(e \in A\) is
and the expected frequency of \(e \in A\) is
The squared-differences, or residual sum of squares, rank \(R_{RSS}(M)\) of \(M\) corresponding to a key \(k \in \ZZ/n\ZZ\) is given by
Cryptanalysis by exhaustive key search produces a candidate decipherment \(M_{k}\) for each possible key \(k \in \ZZ/n\ZZ\). For a set \(D = \big\{M_{k_1}, M_{k_2}, \dots, M_{k_r} \big\}\) of all candidate decipherments corresponding to a ciphertext \(C\), the smaller is the rank \(R_{RSS}(M_{k_i})\) the more likely that \(k_i\) is the secret key. This key ranking method is based on the residual sum of squares measure [RSS09].
INPUT:
OUTPUT:
EXAMPLES:
Use the method of squared differences to rank all possible keys and their corresponding decipherment:
sage: S = ShiftCryptosystem(AlphabeticStrings())
sage: P = S.encoding("Shi."); P
SHI
sage: K = 5
sage: C = S.enciphering(K, P)
sage: Pdict = S.brute_force(C)
sage: S.rank_by_squared_differences(C, Pdict)
[(19, ETU),
(9, ODE),
(20, DST),
(5, SHI),
(8, PEF),
(4, TIJ),
(25, YNO),
(21, CRS),
(6, RGH),
(10, NCD),
(12, LAB),
(23, APQ),
(24, ZOP),
(0, XMN),
(13, KZA),
(15, IXY),
(1, WLM),
(16, HWX),
(22, BQR),
(11, MBC),
(18, FUV),
(2, VKL),
(17, GVW),
(7, QFG),
(3, UJK),
(14, JYZ)]
As more ciphertext is available, the reliability of the squared differences ranking function increases:
sage: P = S.encoding("Shift cipher."); P
SHIFTCIPHER
sage: C = S.enciphering(K, P)
sage: Pdict = S.brute_force(C)
sage: S.rank_by_squared_differences(C, Pdict)
[(20, DSTQENTASPC),
(5, SHIFTCIPHER),
(9, ODEBPYELDAN),
(19, ETURFOUBTQD),
(6, RGHESBHOGDQ),
(16, HWXUIRXEWTG),
(8, PEFCQZFMEBO),
(21, CRSPDMSZROB),
(22, BQROCLRYQNA),
(25, YNOLZIOVNKX),
(3, UJKHVEKRJGT),
(18, FUVSGPVCURE),
(4, TIJGUDJQIFS),
(10, NCDAOXDKCZM),
(7, QFGDRAGNFCP),
(24, ZOPMAJPWOLY),
(2, VKLIWFLSKHU),
(12, LABYMVBIAXK),
(17, GVWTHQWDVSF),
(1, WLMJXGMTLIV),
(13, KZAXLUAHZWJ),
(0, XMNKYHNUMJW),
(15, IXYVJSYFXUH),
(14, JYZWKTZGYVI),
(11, MBCZNWCJBYL),
(23, APQNBKQXPMZ)]
TESTS:
The ciphertext cannot be an empty string:
sage: S.rank_by_squared_differences("", Pdict)
Traceback (most recent call last):
...
AttributeError: 'str' object has no attribute 'parent'
sage: S.rank_by_squared_differences(S.encoding(""), Pdict)
Traceback (most recent call last):
...
ValueError: The ciphertext must be a non-empty string.
sage: S.rank_by_squared_differences(S.encoding(" "), Pdict)
Traceback (most recent call last):
...
ValueError: The ciphertext must be a non-empty string.
The ciphertext must be encoded using the capital letters of the English alphabet as implemented in AlphabeticStrings():
sage: H = HexadecimalStrings()
sage: S.rank_by_squared_differences(H.encoding("shift"), Pdict)
Traceback (most recent call last):
...
TypeError: The ciphertext must be capital letters of the English alphabet.
sage: B = BinaryStrings()
sage: S.rank_by_squared_differences(B.encoding("shift"), Pdict)
Traceback (most recent call last):
...
TypeError: The ciphertext must be capital letters of the English alphabet.
The dictionary pdict cannot be empty:
sage: S.rank_by_squared_differences(C, {})
Traceback (most recent call last):
...
KeyError: 0
REFERENCES:
| [RSS09] | (1, 2) Residual sum of squares. Wikipedia, accessed 13th October 2009. |
Bases: sage.crypto.cryptosystem.SymmetricKeyCryptosystem
Create a substitution cryptosystem.
INPUT:
OUTPUT:
EXAMPLES:
sage: M = AlphabeticStrings()
sage: E = SubstitutionCryptosystem(M)
sage: E
Substitution cryptosystem on Free alphabetic string monoid on A-Z
sage: K = M([ 25-i for i in range(26) ])
sage: K
ZYXWVUTSRQPONMLKJIHGFEDCBA
sage: e = E(K)
sage: m = M("THECATINTHEHAT")
sage: e(m)
GSVXZGRMGSVSZG
TESTS:
sage: M = AlphabeticStrings()
sage: E = SubstitutionCryptosystem(M)
sage: E == loads(dumps(E))
True
Decrypt the ciphertext C using the key K.
INPUT:
OUTPUT:
EXAMPLES:
sage: S = SubstitutionCryptosystem(AlphabeticStrings())
sage: K = S.random_key()
sage: M = S.encoding("Don't substitute me!")
sage: S.deciphering(K, S.enciphering(K, M)) == M
True
Encrypt the plaintext M using the key K.
INPUT:
OUTPUT:
EXAMPLES:
sage: S = SubstitutionCryptosystem(AlphabeticStrings())
sage: K = S.random_key()
sage: M = S.encoding("Don't substitute me.")
sage: S.deciphering(K, S.enciphering(K, M)) == M
True
The encoding of the string M over the string monoid of this substitution cipher. For example, if the string monoid of this cryptosystem is AlphabeticStringMonoid, then the encoding of M would be its upper-case equivalent stripped of all non-alphabetic characters.
INPUT:
OUTPUT:
EXAMPLES:
sage: M = "Peter Pan(ning) for gold."
sage: A = AlphabeticStrings()
sage: S = SubstitutionCryptosystem(A)
sage: S.encoding(M) == A.encoding(M)
True
The inverse key corresponding to the key K. The specified key is a permutation of the cryptosystem alphabet.
INPUT:
OUTPUT:
EXAMPLES:
sage: S = AlphabeticStrings()
sage: E = SubstitutionCryptosystem(S)
sage: K = E.random_key()
sage: L = E.inverse_key(K)
sage: M = S("THECATINTHEHAT")
sage: e = E(K)
sage: c = E(L)
sage: c(e(M))
THECATINTHEHAT
Generate a random key within the key space of this substitution cipher. The generated key is a permutation of the cryptosystem alphabet. Let \(n\) be the length of the alphabet. Then there are \(n!\) possible keys in the key space.
OUTPUT:
EXAMPLES:
sage: A = AlphabeticStrings()
sage: S = SubstitutionCryptosystem(A)
sage: K = S.random_key()
sage: Ki = S.inverse_key(K)
sage: M = "THECATINTHEHAT"
sage: e = S(K)
sage: d = S(Ki)
sage: d(e(A(M))) == A(M)
True
Bases: sage.crypto.cryptosystem.SymmetricKeyCryptosystem
Create a transposition cryptosystem of block length n.
INPUT:
OUTPUT:
EXAMPLES:
sage: S = AlphabeticStrings()
sage: E = TranspositionCryptosystem(S,14)
sage: E
Transposition cryptosystem on Free alphabetic string monoid on A-Z of block length 14
sage: K = [ 14-i for i in range(14) ]
sage: K
[14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1]
sage: e = E(K)
sage: e(S("THECATINTHEHAT"))
TAHEHTNITACEHT
TESTS:
sage: S = AlphabeticStrings()
sage: E = TranspositionCryptosystem(S,14)
sage: E == loads(dumps(E))
True
Decrypt the ciphertext C using the key K.
INPUT:
OUTPUT:
EXAMPLES:
sage: T = TranspositionCryptosystem(AlphabeticStrings(), 14)
sage: K = T.random_key()
sage: M = T.encoding("The cat in the hat.")
sage: T.deciphering(K, T.enciphering(K, M)) == M
True
Encrypt the plaintext M using the key K.
INPUT:
OUTPUT:
EXAMPLES:
sage: T = TranspositionCryptosystem(AlphabeticStrings(), 14)
sage: K = T.random_key()
sage: M = T.encoding("The cat in the hat.")
sage: T.deciphering(K, T.enciphering(K, M)) == M
True
The encoding of the string M over the string monoid of this transposition cipher. For example, if the string monoid of this cryptosystem is AlphabeticStringMonoid, then the encoding of M would be its upper-case equivalent stripped of all non-alphabetic characters.
INPUT:
OUTPUT:
EXAMPLES:
sage: M = "Transposition cipher is not about matrix transpose."
sage: A = AlphabeticStrings()
sage: T = TranspositionCryptosystem(A, 11)
sage: T.encoding(M) == A.encoding(M)
True
The inverse key corresponding to the key K.
INPUT:
OUTPUT:
EXAMPLES:
sage: S = AlphabeticStrings()
sage: E = TranspositionCryptosystem(S, 14)
sage: K = E.random_key()
sage: Ki = E.inverse_key(K)
sage: e = E(K)
sage: d = E(Ki)
sage: M = "THECATINTHEHAT"
sage: C = e(S(M))
sage: d(S(C)) == S(M)
True
Generate a random key within the key space of this transposition cryptosystem. Let \(n > 0\) be the block length of this cryptosystem. Then there are \(n!\) possible keys.
OUTPUT:
EXAMPLES:
sage: S = AlphabeticStrings()
sage: E = TranspositionCryptosystem(S, 14)
sage: K = E.random_key()
sage: Ki = E.inverse_key(K)
sage: e = E(K)
sage: d = E(Ki)
sage: M = "THECATINTHEHAT"
sage: C = e(S(M))
sage: d(S(C)) == S(M)
True
Bases: sage.crypto.cryptosystem.SymmetricKeyCryptosystem
Create a Vigenere cryptosystem of block length n.
INPUT:
OUTPUT:
EXAMPLES:
sage: S = AlphabeticStrings()
sage: E = VigenereCryptosystem(S,14)
sage: E
Vigenere cryptosystem on Free alphabetic string monoid on A-Z of period 14
sage: K = S('ABCDEFGHIJKLMN')
sage: K
ABCDEFGHIJKLMN
sage: e = E(K)
sage: e
Cipher on Free alphabetic string monoid on A-Z
sage: e(S("THECATINTHEHAT"))
TIGFEYOUBQOSMG
TESTS:
sage: S = AlphabeticStrings()
sage: E = VigenereCryptosystem(S,14)
sage: E == loads(dumps(E))
True
Decrypt the ciphertext C using the key K.
INPUT:
OUTPUT:
EXAMPLES:
sage: V = VigenereCryptosystem(AlphabeticStrings(), 24)
sage: K = V.random_key()
sage: M = V.encoding("Jack and Jill went up the hill.")
sage: V.deciphering(K, V.enciphering(K, M)) == M
True
Encrypt the plaintext M using the key K.
INPUT:
OUTPUT:
EXAMPLES:
sage: V = VigenereCryptosystem(AlphabeticStrings(), 24)
sage: K = V.random_key()
sage: M = V.encoding("Jack and Jill went up the hill.")
sage: V.deciphering(K, V.enciphering(K, M)) == M
True
The encoding of the string M over the string monoid of this Vigenere cipher. For example, if the string monoid of this cryptosystem is AlphabeticStringMonoid, then the encoding of M would be its upper-case equivalent stripped of all non-alphabetic characters.
INPUT:
OUTPUT:
EXAMPLES:
sage: A = AlphabeticStrings()
sage: V = VigenereCryptosystem(A, 24)
sage: M = "Jack and Jill went up the hill."
sage: V.encoding(M) == A.encoding(M)
True
The inverse key corresponding to the key K.
INPUT:
OUTPUT:
EXAMPLES:
sage: S = AlphabeticStrings()
sage: E = VigenereCryptosystem(S,14)
sage: K = E.random_key()
sage: L = E.inverse_key(K)
sage: M = S("THECATINTHEHAT")
sage: e = E(K)
sage: c = E(L)
sage: c(e(M))
THECATINTHEHAT
Generate a random key within the key space of this Vigenere cryptosystem. Let \(n > 0\) be the length of the cryptosystem alphabet and let \(m > 0\) be the block length of this cryptosystem. Then there are \(n^m\) possible keys.
OUTPUT:
EXAMPLES:
sage: A = AlphabeticStrings()
sage: V = VigenereCryptosystem(A, 14)
sage: M = "THECATINTHEHAT"
sage: K = V.random_key()
sage: Ki = V.inverse_key(K)
sage: e = V(K)
sage: d = V(Ki)
sage: d(e(A(M))) == A(M)
True